PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000462997
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 435aa    MW: 47505.8 Da    PI: 6.5382
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000462997genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.63.1e-17222256135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  MDP0000462997 222 CLHCAAEKTPQWRTGPLGPKTLCNACGVRYKSGRL 256
                    99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.281216252IPR000679Zinc finger, GATA-type
SMARTSM004012.0E-15216266IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-13217253IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577163.8E-14217279No hitNo description
CDDcd002022.61E-12221278No hitNo description
PfamPF003206.4E-15222256IPR000679Zinc finger, GATA-type
PROSITE patternPS003440222247IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MELPEFYRGG YFNGGAAKLS PGDKPTGGDF TVEDLLDFSN EDPFITTAAD GGSFHNPAAE  60
SSAVTAVDSC NSSVSGGEPH FSGNRSFDDS QFSGDLCVPC DDLAELEWLS NFVEDSFSAD  120
KDLQSLQFLS VSNTTKPQTP ETCSSSETPQ NALLFPSETP LPGKARSKRS RAAPGDWSTR  180
LLHLITPNNN TKPPKTTLPK KRDAAIGAGN SNSGSDSSGR KCLHCAAEKT PQWRTGPLGP  240
KTLCNACGVR YKSGRLVPEY RPAASPTFMS ARHSNSHRKV LELRRQKEVQ RSHHHHHQYL  300
SPGSIFGVSN GGHDDYLIHH HNIHGANQAH HHELSYLECL ICSIFHRYNL TGIIDGSVLP  360
PPKFLHDAFG NSSTPLNPDY VTWFENDQTI LIWLNSTLFD LLILNIIGVT SSCDLWSKLE  420
SQLAMASQSH IHEL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008380945.10.0PREDICTED: GATA transcription factor 12-like
TrEMBLM5WXU81e-179M5WXU8_PRUPE; Uncharacterized protein
STRINGGLYMA07G01960.21e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.14e-67GATA transcription factor 9